immunomodulation comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Clinical research has examined the peptide in chronic hepatitis B and C, as a vaccine adjuvant, and in sepsis and oncology settings. Results across trials have been mixed, and several studies were small or conducted under differing protocols. Regulatory status varies by country, and the compound is not approved in every jurisdiction where it is studied. Evidence for any single indication should be read with attention to sample size and endpoint choice.
Thymosin alpha-1 is a 28-residue peptide first isolated from thymus tissue in the 1970s. It corresponds to the N-terminal portion of thymosin beta-4, from which it is cleaved in vivo. The peptide carries an acetyl group at its N-terminus, a modification that affects its charge and stability. Synthetic material produced by solid-phase peptide synthesis is chemically identical to the natural fragment and is the form used in research and clinical studies.
Laboratory work indicates that the peptide acts on cells of both the innate and adaptive immune systems. Reported effects include signalling through Toll-like receptors on dendritic cells, enhanced T-cell maturation, and increased natural killer cell activity. These actions are described largely from cell-culture and animal experiments, and the precise receptor-level events remain incompletely defined. Studies in humans have generally measured immune markers rather than a single defined molecular target. The resulting picture remains partly descriptive.
Identity and purity are usually checked by reverse-phase high-performance liquid chromatography, which separates the intact chain from truncated products, together with mass spectrometry for confirmation of the expected mass. Peptide mapping after enzymatic digestion and amino acid analysis add sequence-level evidence. Release testing also covers water content, residual solvents, and counter-ions, all of which influence measured mass and stability. Related-peptide limits are commonly expressed as a percentage of total peak area, with individual unspecified impurities held below a lower threshold.
The lyophilized peptide is a white to off-white powder that dissolves freely in water and in aqueous buffers near neutral pH. Because the molecule carries a net negative charge under physiological conditions, saline and phosphate solutions are the usual vehicles, while strongly acidic media are avoided. Stock solutions are commonly divided into small aliquots so that repeated freezing and thawing can be limited, since cycling may encourage aggregation. Solubility in organic solvents is poor and those solvents are seldom used as primary diluents.
Recommended storage for the dry powder is a freezer near minus twenty degrees Celsius, kept desiccated and away from light. Once dissolved, the peptide is less stable and is usually held at two to eight degrees Celsius for short intervals or frozen for longer storage. Stability studies focus on the acetylated terminus and the disulfide linkage because those features define the intact molecule. Common degradation routes include cysteine oxidation, deamidation of asparagine or glutamine side chains, and slow formation of higher-molecular-weight species.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Peptide | 28 amino acid residues |
| Molecular weight | Approximately 3108 Da | Depends on acetylation state |
| N-terminal modification | Acetylated | Affects charge and stability |
| Natural source | Fragment of thymosin beta-4 | Cleaved in vivo |
| Sequence length | 28 residues | Synthetic form matches natural |
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
Thymosin alpha 1 is a short peptide of 28 amino acid residues that derives from the amino terminal region of a larger precursor protein known as prothymosin alpha. The peptide carries an acetyl group on its first residue and contains no disulfide bonds or carbohydrate chains. Its sequence is highly conserved across mammalian species, which is one reason laboratories treat it as a molecule with a defined and reproducible structure rather than a variable tissue extract. The name follows an early naming convention for thymus-derived fractions and does not imply that the peptide acts as a hormone in the classical endocrine sense.
The compound has been investigated as an adjunct in chronic viral hepatitis and as a vaccine adjuvant, with results that vary by study design and population. Regulators in some countries have approved a synthetic form for specific indications, while other agencies have not. Whether the peptide produces consistent clinical benefit across diverse patient groups is still an open question, and many trials have been small. Its status is therefore best described as investigational in many contexts and established only narrowly.
The name itself causes confusion, because several unrelated thymic peptides share the thymosin label. Thymosin beta-4, for example, is a different molecule with different functions. Naming conventions in the literature also mix descriptive research terms with assigned nonproprietary names, so a reader should confirm which entity a given paper addresses. Clarifying that point is usually the first step in interpreting any claim about this peptide.
Immune signaling studies link thymosin alpha 1 to Toll-like receptor pathways, particularly TLR2 and TLR9, on dendritic cells and other antigen-presenting cells. Activation of these receptors promotes maturation of T cells and increases natural killer cell activity. The peptide shifts cytokine output toward a T helper 1 profile, raising interferon gamma and interleukin 2 while modulating interleukin 10. Whether these effects translate into clinical benefit for any specific disease remains a subject of debate. Reported outcomes vary across trials and populations.
Thymosin alpha 1 is approved as a medicine in several countries, including Italy and China, for indications such as chronic hepatitis B and as an immune adjuvant. It is not approved by the United States Food and Drug Administration as a therapeutic product. In research settings the peptide appears in studies of sepsis, vaccine response, and oncology support, often with mixed or inconclusive results. The evidence base is uneven, and reviews note that many trials were small. Regulatory status therefore differs widely between jurisdictions.
Quantifying thymosin alpha-1 in a sample usually relies on reverse-phase high-performance liquid chromatography. The peptide lacks strong chromophores, so detection often occurs at 214 nm, where the peptide backbone absorbs. Mass spectrometry provides confirmatory identification and can detect sequence variants or truncations. Immunoassays have been used in biological matrices, but they may cross-react with related fragments. For purity assessment, chromatographic peak area gives the main component percentage, while mass accuracy verifies molecular identity.
The lyophilized peptide is generally stable for extended periods when kept cold and dry. Once dissolved, aqueous solutions are less stable; hydrolysis, oxidation, and aggregation can degrade the material. Storage at -20 °C or lower slows these processes. Repeated freeze-thaw cycles are best avoided because they can promote aggregation. The exact shelf life depends on formulation, pH, and concentration, so stability studies are typically performed for each specific product.
In the healthcare industry, open-source AI has been used in diagnostics, patient care, and personalized treatment options. Open-source libraries have been used for medical imaging for tasks such as tumor detection, improving the speed and accuracy of diagnostic processes. Additionally, OpenChem, an open-source library specifically geared toward chemistry and biology applications, enables the development of predictive models for drug discovery, helping researchers identify potential compounds for treatment.
=== Odor === Feces possesses physiological odor, which can vary according to diet and health status. For example, meat protein is rich in the amino acid methionine, which is a precursor of the sulfur-containing odorous compounds listed below. The odor of human feces is suggested to be made up from the following odorant volatiles:
== Interactions == Combination of tiagabine with enzyme-inducing anticonvulsants like carbamazepine, phenytoin, primidone, and phenobarbital can decrease the elimination half-life of tiagabine to as low as 2 to 3 hours. Conversely, tiagabine does not significantly affect the hepatic metabolism of other anticonvulsants such as carbamazepine, phenytoin, and valproic acid. Other interactions have also been reviewed.
As examples, Moderna's RNA vaccine candidate requires cold chain management just above freezing temperatures between 2 and 8 °C (36 and 46 °F) with limited storage duration (30 days), but the Pfizer-BioNTech RNA candidate requires storage between −80 and −60 °C (−112 and −76 °F), or colder throughout deployment until vaccination. In February 2021, Pfizer and BioNTech asked the U.S. Food and Drug Administration (FDA) to update the emergency use authorization (EUA) to permit the vaccine to be stored at between −25 and −15 °C (−13 and 5 °F) for up to two weeks before use. As of May 2021, Walvax is conducting Phase III trials for its mRNA vaccine which could be stored at room temperature for six months. After a vaccine vial is punctured to administer a dose, it is viable for only six hours, then must be discarded, requiring attention to local management of cold storage and vaccination processes. Because the COVID‑19 vaccine will likely be in short supply for many locations during early deployment, vaccination staff will have to avoid spoilage and waste, which typically are as much as 30% of the supply. The cold chain is further challenged by the type of local transportation for the vaccines in rural communities, such as by motorcycle or delivery drone, need for booster doses, use of diluents, and access to vulnerable populations, such as healthcare staff, children and the elderly.
For instance, the character Miss Ackerman from iCarly was described as "crazy" and "looney." The study concluded that progress in addressing mental illness representation in children's television has been limited, with many negative portrayals still present.
Sources: en.wikipedia.org
Cetacean species recorded as prey include small toothed whales like bottlenose dolphins, common dolphins, Indo-Pacific humpback dolphins, striped dolphins, Risso's dolphins, and harbor porpoises. Bite wounds from white sharks have also been documented on species as large as beaked whales. White sharks typically attack toothed whales from behind—beyond the prey's echolocation—and target the tail, underside, or dorsal area. There are two records of white sharks managing to kill small humpback whales which were weakened by net entanglement. One case involved two sharks employing strategic bites while in the other a single shark managed to drown its victim. White sharks are more likely to scavenge large whales than hunt them. When a carcass is available, multiple sharks will gorge themselves, ripping off chunks by shaking their heads side-to-side. They may spit out pieces, possibly judging them to be too low in energy, using their teeth to detect pressure and assess the fat content. The sharks do not appear to act aggressively towards each other, but accidental bites can occur. They eventually become lethargic from overconsumption; they can no longer lift their heads out of the water, nor can they get in a good bite as they bump into the dead whale. White sharks feed on numerous fish species, including other sharks. One 2023 study found that juvenile and subadult white sharks off the east coast of Australia fed primarily on ray-finned fishes, particularly flathead grey mullets, Japanese scads, and various species of porgies, mackerels, and tuna.
Bayesian inference also incorporates a model of evolution and the main advantages over MP and ML are that it is computationally more efficient than traditional methods, it quantifies and addresses the source of uncertainty and is able to incorporate complex models of evolution.
The tenets of Sikhism do not advocate a particular stance on either vegetarianism or the consumption of meat, but leave the decision of diet to the individual. The tenth guru, Guru Gobind Singh, however, prohibited "Amritdhari" Sikhs, or those that follow the Sikh Rehat Maryada (the Official Sikh Code of Conduct) from eating Kutha meat, or meat which has been obtained from animals which have been killed in a ritualistic way. This is understood to have been for the political reason of maintaining independence from the then-new Muslim hegemony, as Muslims largely adhere to the ritualistic halal diet. "Amritdharis" that belong to some Sikh sects (e.g. Akhand Kirtani Jatha, Damdami Taksal, Namdhari and Rarionwalay, etc.) are vehemently against the consumption of meat and eggs (though they do consume and encourage the consumption of milk, butter and cheese). This vegetarian stance has been traced back to the times of the British Raj, with the advent of many new Vaishnava converts. In response to the varying views on diet throughout the Sikh population, Sikh Gurus have sought to clarify the Sikh view on diet, stressing their preference only for simplicity of diet. Guru Nanak said that over-consumption of food (Lobh, Greed) involves a drain on the Earth's resources and thus on life. Passages from the Guru Granth Sahib (the holy book of Sikhs, also known as the Adi Granth) say that it is "foolish" to argue for the superiority of animal life, because though all life is related, only human life carries more importance: "Only fools argue whether to eat meat or not.
Charleys Cheesesteaks, officially Charleys Philly Steaks, is an American restaurant chain specializing in Philly cheesesteak headquartered in Columbus, Ohio. Formerly known as Charley's Steakery and Charley's Grilled Subs, the franchise was established in 1986 on the campus of Ohio State University. By 2017 there were 600 locations in 45 states and in 19 countries. Charleys is believed to have doubled in size in 2021. In addition to traditional Philly cheesesteaks, the chain also has other steak based sandwiches and multiple grilled chicken sandwiches, among other grilled sandwiches.
Sources: en.wikipedia.org
== Anopheles gambiae in the strict sense == An. gambiae sensu stricto (s.s.) has been discovered to be currently in a state of diverging into two different species—the Mopti (M) and Savannah (S) strains—though as of 2007, the two strains are still considered to be a single species. A mechanism of species recognition using the sound emitted by the wings and identified by Johnston's organ was proposed in 2010, however this mechanism has never been confirmed since, and the overall mechanism theory through "harmonic convergence" has been challenged.
== Models == Several theoretical models and possible mechanisms of de novo gene birth have been described. The models are generally not mutually exclusive, and it is possible that multiple mechanisms may give rise to de novo genes. An example is the type III antifreeze protein gene, which originates from an old sialic acid synthase (SAS) gene, in an Antarctic zoarcid fish.
== Concerns == Concerns over AI agents include potential issues of liability, an increased risk of cybercrime, ethical challenges, and problems related to AI safety and AI alignment. Other issues involve data privacy, weakened human oversight, a lack of guaranteed repeatability, reward hacking, algorithmic bias, compounding software errors, lack of explainability of agents' decisions, security vulnerabilities, stifling competition, problems with underemployment, job displacement, cognitive offloading, and the potential for user manipulation, misinformation or malinformation. They may also complicate legal and risk-assessment frameworks, foster hallucinations, hinder countermeasures against rogue agents, and suffer from the lack of standardized evaluation methods. Enterprise deployment of AI agents has raised contracting concerns related to liability allocation, data ownership rights, and legal accountability. They have also been criticized for being expensive, having a negative impact on internet traffic, and potentially damaging to the environment due to high energy usage. According to Nvidia CEO Jensen Huang, AI agents would require 100 times more computing power than LLMs. There is also the risk of increased political corruption, as AI agents may not question instructions in the same way that humans would. Journalists have described AI agents as part of a push by Big Tech companies to "automate everything". Several of those companies' CEOs stated in early 2025 that they expect AI agents to eventually "join the workforce".
Using purified proteins on substrates including artificial lipid bilayers and flow-based adhesion assays, his lab discovered the first heterophilic (like-unlike) receptor–counter-receptor adhesion pairs in all of cell biology, including CD2–LFA-3 and LFA-1–ICAM. The LFA-1–ICAM interaction required Mg2+, and explained the Mg2+-dependence of cell adhesion in antigen recognition. Subsequently, Springer structurally resolved the LFA-1–ICAM-1 interaction, with Mg2+ at the ligand-binding interface.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
It corresponds to the first 28 amino acids of thymosin beta-4, a larger protein found in many tissues. The fragment is acetylated at its N-terminus and is produced synthetically for research and pharmaceutical use. Synthetic and natural forms share the same sequence.
It is usually described as an immunomodulatory peptide rather than a classical hormone. It does not travel to a single distant organ in the manner of an endocrine hormone. Classification varies across sources, and some texts group it with thymic peptides generally.
The broad outline involves immune cell activation, but the specific molecular steps remain under investigation. Different studies report effects on dendritic cells, T cells, and natural killer cells. No single receptor has been confirmed as the sole mediator.
Reconstituted solutions are typically kept refrigerated at two to eight degrees Celsius when used within a short window, or frozen in aliquots for longer periods. Repeated freeze-thaw cycles are avoided because they can reduce recovery of intact peptide.